Product Description:

Cupid-MDM2-A peptide:

• Cargo: Residues 27 to 107 of human MDM2

• Domain type: SWIB Motif, SWIB / MDM2 domain (P53 binding)

• 81 Amino acids

LVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTK

RLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTM

IYRNL

Product Characteristics:

• Molecular weight (daltons): 17212

• Isoelectric point (pI): 9.6

• Extinction Coefficient (A280 reduced) : 17420

• Solubility : >200 micromolar

• Purity: 83%

• Cell-Permeation : Passes

• 1 Unit = 10 nanomoles = 0.172 mg

Cupid-MDM2-A Peptide Data:

Cell permeating Cupid MDM2 peptide AA. Purified Cupid-MDM2-A peptide was subjected to SDS-PAGE alongside a prestained molecular marker ladder. The gel was then stained for protein with a commercial coomassie-based stain.

M = Weight markers shown in kD

S  = Cupid-MDM2-A Peptide sample.

Cell permeating Cupid MDM2 peptide A

B. Cupid-MDM2-A peptide labelled with fluorescein was subjected to SDS-PAGE and observed with a blue light transilluminator.

M = Weight markers shown in Kd

S = Labelled Cupid-MDM2-A Peptide sample.

C. Labelled peptide was incubated with living cells at 10 micromolar for 60 minutes before exchanging the media and washing the cells. Cells were imaged using a fluorescence microscope with filter sets for Fluorescein (Upper Panel) or phase contrast (Lower Panel). Fluorescent images of treated cells are taken at a setting where the background (autofluorescence) of the untreated cells is at the threshold of detection. We observe the peptide fluorescence distributed diffusely throughout all cells.