Cupid-Nemo-D


Cupid Nemo C Cell Permeation

Cupid Nemo D Cell Permeation:

 

B. Cupid-Nemo-D peptide labelled with fluorescein was subjected to SDS-PAGE and observed with a blue light transilluminator.

 

M = Weight markers shown in Kd, S = Labelled Cupid-Nemo-D Peptide sample.

 

C. Labelled peptide was incubated with living cells at 10 micromolar for 60 minutes before exchanging the media and washing the cells. Cells were imaged using a fluorescence microscope with filter sets for Fluorescein (Upper Panel) or phase contrast (Lower Panel). Fluorescent images of treated cells are taken at a setting where the background (autofluorescence) of the untreated cells is at the threshold of detection. We observe the peptide fluorescence distributed diffusely throughout all cells.

Cupid-Nemo-D

Cupid-Nemo-C

Product Description:

 

Cupid Nemo D peptide:

 

• Cargo: Residues 300 to 343 of Human NF-kappa-B essential modulator isoform a (NEMO)

• Domain type: Leucine Zipper

• 44 Amino acids

 

VLKAQADIYKADFQAERQAREKLAEKKELLQE

QLEQLQREYSKL

 

Product Characteristics:

 

• Molecular weight (daltons): 12888

• Isoelectric point (pI): 9.16

• Extinction Coefficient (A280 reduced) : 9970

• Solubility : >200 micromolar

• Purity: 94%

• Cell-Permeation : Passes

• 1 Unit = 10 nanomoles = 0.129 mg

Cupid-Nemo-A Peptide Data

Cupid-Nemo-D Peptide Data:

 

A. Purified Cupid-Nemo-D peptide was subjected to SDS-PAGE alongside a prestained molecular marker ladder. The gel was then stained for protein with a commercial coomassie-based stain.

 

M = Weight markers shown in kD

 

S = Cupid Nemo-D Peptide sample

 

Contact Us

Powered By: The Digital Dragons - Terms & Conditions | Cupidpeptides © 2013 | All Rights Reserved