Cupid-Oct4-Transcription-Factor


Cupid-Oct4

Cupid Cupid-Oct4

Transcription Factor Permeation:

 

B. Cupid-Oct4 protein labelled with fluorescein was subjected to SDS-PAGE and observed with a blue light transilluminator.

 

M = Weight markers shown in Kd, S = Labelled Cupid-Oct4 protein sample.

 

C. Labelled protein was incubated with living cells at 5 micromolar for 60 minutes before exchanging the media and washing the cells. Cells were imaged using a fluorescence microscope with filter sets for Fluorescein (Upper Panel) or phase contrast (Lower Panel). Fluorescent images of treated cells are taken at a setting where the background (autofluorescence) of the untreated cells is at the threshold of detection. We observe the Cupid-Oct4 protein fluorescence distributed diffusely throughout all cells.

Cupid-Oct4 Transcription Factor

Cupid-Oct4 Transcription Factor

Product Description:

 

Cupid-Oct4 Protein:

• Cargo: Residues 2 to 360 of human Oct4

• Domain type: : Full Human Protein.

• 359 Amino acids

 

AGHLASDFAFSPPPGGGGDGPGGPEPGWVDP

RTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCP

PPYEFCGG MAYCGPQVGVG LVPQGG LETSQPE

GEAGVGVESNSDGASPEPCTVTPGAVKLEKEKL

EQNPEESQDI KALQKELEQFAKLLKQKRITLGYT

QADVG LTLGVLFGKVFSQTTICRFEALQLSFKNM

CKLRPLLQKWVEEADNNENLQEICKAETLVQAR

KRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQ

QLGLEKDWRVWFCNRRQKGKRSSSDYAQRED

FEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFT

ALYSSVPFPEGEAFPPVSVTTLGSPMHSN

 

Product Characteristics:

 

• Molecular weight (daltons): 46036

• Isoelectric point (pI): 7.22

• Extinction Coefficient (A280 reduced) : 43430

• Solubility : >200 micromolar

• Purity: 85%

• Cell-Permeation : Passes

• 1 Unit = 10 nanomoles = 0.46 mg

Cupid-Nemo-E Peptide Data

Cupid-Oct4 Protein Data

 

A. Purified Cupid-Oct4 protein was subjected to SDS-PAGE alongside a prestained molecular marker ladder. The gel was then stained for protein with a commercial coomassie-based stain.

 

M = Weight markers shown in kD

 

S = Cupid-Oct4 protein sample

 

Contact Us

Powered By: The Digital Dragons - Terms & Conditions | Cupidpeptides © 2013 | All Rights Reserved