Cupid-KLF4-Transcription-Factor


Cupid-KLF4

Cupid-KLF4

Transcription Factor Permeation:

 

B. Cupid-KLF4 protein labelled with fluorescein was subjected to SDS-PAGE and observed with a blue light transilluminator.

 

M = Weight markers shown in Kd, S = Labelled Cupid-KLF4 protein sample.

 

C. Labelled protein was incubated with living cells at 5 micromolar for 60 minutes before exchanging the media and washing the cells. Cells were imaged using a fluorescence microscope with filter sets for Fluorescein (Upper Panel) or phase contrast (Lower Panel). Fluorescent images of treated cells are taken at a setting where the background (autofluorescence) of the untreated cells is at the threshold of detection. We observe the Cupid-KLF4 protein fluorescence distributed diffusely throughout all cells.

Cupid-KLF4 Transcription Factor

Cupid-KLF4 Transcription Factor

Product Description:

 

Cupid-KLF4 Protein:

 

• Cargo: Residues 2 to 479 of human KLF4

• Domain type: : Full Human Protein.

• 478 Amino acids

 

RQPPG ESDMAVSDALLPS FSTFASGPAGREKTL

ROAGAPNNRWREELSHMKRLPPVLPGRPYDLA

AATVATDLESGGAGAACGGSNLAPLPRRETEEF

NDLLDLDFILSNSLTHPPESVAATVSSSASASSSSS

PSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTG

GGLLYGRESAPPPTAPFNLADINDVSPSGGFVAE

LLRPELDPWI PPQQPQP PGGGLMGKFVLKASLS

APGSEYGSPSVISVISKGSPDGSHPVVVAPYNGG

PPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAA

HDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLP

PGFHPHPGPNYPSFLPDQMQPQVPPLHYQELM

PPGSCM PEEPKPKRGRRSWPRKRTATHTCDYA

GCGKTYTKSSH LKAHLRTHTGEKPYHCDWDGC

GWKFARSDELTR HYR KHTGHRPFQCQKCDRAF

SRSDHLALHMKRHF

 

Product Characteristics:

 

• Molecular weight (daltons): 58555

• Isoelectric point (pI): 8.92

• Extinction Coefficient (A280 reduced) : 46870

• Solubility : >200 micromolar

• Purity: 85%

• Cell-Permeation : Passes

• 1 Unit = 10 nanomoles = 0.55 mg

Cupid-KLF4 Protein Data

Cupid-KLF4 Protein Data

 

A. Purified Cupid-KLF4 protein was subjected to SDS-PAGE alongside a prestained molecular marker ladder. The gel was then stained for protein with a commercial coomassie-based stain.

 

M = Weight markers shown in kD

 

S = Cupid-KLF4 protein sample

 

Contact Us

Powered By: The Digital Dragons - Terms & Conditions | Cupidpeptides © 2013 | All Rights Reserved